Class g: Small proteins [56992] (75 folds) |
Fold g.10: Hairpin loop containing domain-like [57413] (1 superfamily) alpha+beta fold with two crossing loops |
Superfamily g.10.1: Hairpin loop containing domain-like [57414] (3 families) the middle part is structurally similar to some knottins and defensins but differs in the disulfide pattern |
Family g.10.1.1: Hairpin loop containing domain [57415] (1 protein) |
Protein Hepatocyte growth factor [57416] (1 species) heparin-binding domain |
Species Human (Homo sapiens) [TaxId:9606] [57417] (6 PDB entries) |
Domain d1gp9b1: 1gp9 B:39-125 [65444] Other proteins in same PDB: d1gp9a2, d1gp9b2, d1gp9c2, d1gp9d2 |
PDB Entry: 1gp9 (more details), 2.5 Å
SCOP Domain Sequences for d1gp9b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gp9b1 g.10.1.1 (B:39-125) Hepatocyte growth factor {Human (Homo sapiens)} vhefkksakttlikidpalkiktkkvntadqcanrctrnkglpftckafvfdkarkqclw fpfnsmssgvkkefghefdlyenkdyi
Timeline for d1gp9b1: