Lineage for d1gp9a2 (1gp9 A:126-208)

  1. Root: SCOP 1.69
  2. 520835Class g: Small proteins [56992] (75 folds)
  3. 522773Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 522774Superfamily g.14.1: Kringle-like [57440] (2 families) (S)
  5. 522775Family g.14.1.1: Kringle modules [57441] (6 proteins)
  6. 522792Protein NK1 fragment of hepatocyte growth factor [57457] (1 species)
  7. 522793Species Human (Homo sapiens) [TaxId:9606] [57458] (5 PDB entries)
  8. 522798Domain d1gp9a2: 1gp9 A:126-208 [65443]
    Other proteins in same PDB: d1gp9a1, d1gp9b1, d1gp9c1, d1gp9d1

Details for d1gp9a2

PDB Entry: 1gp9 (more details), 2.5 Å

PDB Description: a new crystal form of the nk1 splice variant of hgf/sf demonstrates extensive hinge movement and suggests that the nk1 dimer originates by domain swapping

SCOP Domain Sequences for d1gp9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gp9a2 g.14.1.1 (A:126-208) NK1 fragment of hepatocyte growth factor {Human (Homo sapiens)}
rnciigkgrsykgtvsitksgikcqpwssmiphehsflpssyrgkdlqenycrnprgeeg
gpwcftsnpevryevcdipqcse

SCOP Domain Coordinates for d1gp9a2:

Click to download the PDB-style file with coordinates for d1gp9a2.
(The format of our PDB-style files is described here.)

Timeline for d1gp9a2: