SCOP 1.59: Domain d1gp9b1: 1gp9 B:39-125

Lineage for d1gp9b1 (1gp9 B:39-125)

1. Root: SCOP 1.59

2. Class g: Small proteins [56992] (58 folds)

3. Fold g.10: Hairpin loop containing domain-like [57413] (1 superfamily)

4. Superfamily g.10.1: Hairpin loop containing domain-like [57414] (2 families)

5. Family g.10.1.1: Hairpin loop containing domain [57415] (1 protein)

6. Protein Hepatocyte growth factor [57416] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57417] (6 PDB entries)

8. Domain d1gp9b1: 1gp9 B:39-125 [65444]
   Other proteins in same PDB: d1gp9a2, d1gp9b2, d1gp9c2, d1gp9d2

Details for d1gp9b1

PDB Entry: 1gp9, 2.5 Å

PDB Description: a new crystal form of the nk1 splice variant of hgf/sf demonstrates extensive hinge movement and suggests that the nk1 dimer originates by domain swapping

SCOP Domain Sequences for d1gp9b1:

Sequence; same for both SEQRES and ATOM records:

>d1gp9b1 g.10.1.1 (B:39-125) Hepatocyte growth factor {Human (Homo sapiens)}
vhefkksakttlikidpalkiktkkvntadqcanrctrnkglpftckafvfdkarkqclw
fpfnsmssgvkkefghefdlyenkdyi

Timeline for d1gp9b1:

• d1gp9b1 is new in SCOP 1.59
  
• d1gp9b1 appears in SCOP 1.61
  
• d1gp9b1 appears in the current release, SCOPe 2.08