Lineage for d1goib3 (1goi B:292-379)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 190761Fold d.26: FKBP-like [54533] (3 superfamilies)
  4. 190858Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 190859Family d.26.3.1: Chitinase insertion domain [54557] (6 proteins)
  6. 190873Protein Chitinase B [54560] (1 species)
  7. 190874Species Serratia marcescens [TaxId:615] [54561] (8 PDB entries)
  8. 190876Domain d1goib3: 1goi B:292-379 [65418]
    Other proteins in same PDB: d1goia1, d1goia2, d1goib1, d1goib2

Details for d1goib3

PDB Entry: 1goi (more details), 1.45 Å

PDB Description: crystal structure of the d140n mutant of chitinase b from serratia marcescens at 1.45 a resolution

SCOP Domain Sequences for d1goib3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1goib3 d.26.3.1 (B:292-379) Chitinase B {Serratia marcescens}
ygrafkgvsggnggqysshstpgedpypstdywlvgceecvrdkdpriasyrqleqmlqg
nygyqrlwndktktpylyhaqnglfvty

SCOP Domain Coordinates for d1goib3:

Click to download the PDB-style file with coordinates for d1goib3.
(The format of our PDB-style files is described here.)

Timeline for d1goib3: