SCOPe 2.08: Domain d1goib3: 1goi B:292-379

Lineage for d1goib3 (1goi B:292-379)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.3: Chitinase insertion domain [54556] (1 family)

5. Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)

6. Protein Chitinase B [54560] (1 species)

7. Species Serratia marcescens [TaxId:615] [54561] (18 PDB entries)

8. Domain d1goib3: 1goi B:292-379 [65418]
   Other proteins in same PDB: d1goia1, d1goia2, d1goib1, d1goib2
   complexed with gol, so4; mutant

Details for d1goib3

PDB Entry: 1goi, 1.45 Å

PDB Description: crystal structure of the d140n mutant of chitinase b from serratia marcescens at 1.45 a resolution

PDB Compounds: (B:) chitinase b

SCOPe Domain Sequences for d1goib3:

Sequence; same for both SEQRES and ATOM records:

>d1goib3 d.26.3.1 (B:292-379) Chitinase B {Serratia marcescens [TaxId: 615]}
ygrafkgvsggnggqysshstpgedpypstdywlvgceecvrdkdpriasyrqleqmlqg
nygyqrlwndktktpylyhaqnglfvty

Timeline for d1goib3:

• d1goib3 first appeared in SCOP 1.59
  
• d1goib3 appears in SCOPe 2.07