SCOP 1.61: Domain d1goia3: 1goi A:292-379

Lineage for d1goia3 (1goi A:292-379)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)

4. Superfamily d.26.3: Chitinase insertion domain [54556] (1 family)

5. Family d.26.3.1: Chitinase insertion domain [54557] (6 proteins)

6. Protein Chitinase B [54560] (1 species)

7. Species Serratia marcescens [TaxId:615] [54561] (8 PDB entries)

8. Domain d1goia3: 1goi A:292-379 [65415]
   Other proteins in same PDB: d1goia1, d1goia2, d1goib1, d1goib2

Details for d1goia3

PDB Entry: 1goi, 1.45 Å

PDB Description: crystal structure of the d140n mutant of chitinase b from serratia marcescens at 1.45 a resolution

SCOP Domain Sequences for d1goia3:

Sequence; same for both SEQRES and ATOM records:

>d1goia3 d.26.3.1 (A:292-379) Chitinase B {Serratia marcescens}
ygrafkgvsggnggqysshstpgedpypstdywlvgceecvrdkdpriasyrqleqmlqg
nygyqrlwndktktpylyhaqnglfvty

Timeline for d1goia3:

• d1goia3 first appeared in SCOP 1.59
  
• d1goia3 appears in SCOP 1.63
  
• d1goia3 appears in the current release, SCOPe 2.08