SCOPe 2.01: Domain d1gl0i_: 1gl0 I:

Lineage for d1gl0i_ (1gl0 I:)

1. Root: SCOPe 2.01

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.4: PMP inhibitors [57282] (1 superfamily)
   disulfide-rich fold; all-beta: 3 antiparallel strands

4. Superfamily g.4.1: PMP inhibitors [57283] (1 family)

5. Family g.4.1.1: PMP inhibitors [57284] (4 proteins)

6. Protein Protease inhibitor PMP-D2V [69943] (1 species)

7. Species Migratory locust (Locusta migratoria) [TaxId:7004] [69944] (1 PDB entry)

8. Domain d1gl0i_: 1gl0 I: [65271]
   Other proteins in same PDB: d1gl0e_
   complexed with cd

Details for d1gl0i_

PDB Entry: 1gl0, 3 Å

PDB Description: structure of the complex between bovine alpha-chymotrypsin and pmp-d2v, an inhibitor from the insect locusta migratoria

PDB Compounds: (I:) protease inhibitor lcmi I

SCOPe Domain Sequences for d1gl0i_:

Sequence; same for both SEQRES and ATOM records:

>d1gl0i_ g.4.1.1 (I:) Protease inhibitor PMP-D2V {Migratory locust (Locusta migratoria) [TaxId: 7004]}
kctpgqvkqqdcntctctptgvwgctlmgcqp

Timeline for d1gl0i_:

• d1gl0i_ first appeared in SCOP 1.59
  
• d1gl0i_ appears in SCOP 1.75
  
• d1gl0i_ appears in SCOPe 2.02
  
• d1gl0i_ appears in the current release, SCOPe 2.08