SCOP 1.59: Domain d1gl0i_: 1gl0 I:

Lineage for d1gl0i_ (1gl0 I:)

1. Root: SCOP 1.59

2. Class g: Small proteins [56992] (58 folds)

3. Fold g.4: PMP inhibitors [57282] (1 superfamily)

4. Superfamily g.4.1: PMP inhibitors [57283] (1 family)

5. Family g.4.1.1: PMP inhibitors [57284] (4 proteins)

6. Protein Protease inhibitor PMP-D2V [69943] (1 species)

7. Species Migratory locust (Locusta migratoria) [TaxId:7004] [69944] (1 PDB entry)

8. Domain d1gl0i_: 1gl0 I: [65271]
   Other proteins in same PDB: d1gl0e_

Details for d1gl0i_

PDB Entry: 1gl0, 3 Å

PDB Description: structure of the complex between bovine alpha-chymotrypsin and pmp-d2v, an inhibitor from the insect locusta migratoria

SCOP Domain Sequences for d1gl0i_:

Sequence; same for both SEQRES and ATOM records:

>d1gl0i_ g.4.1.1 (I:) Protease inhibitor PMP-D2V {Migratory locust (Locusta migratoria)}
kctpgqvkqqdcntctctptgvwgctlmgcqp

Timeline for d1gl0i_:

• d1gl0i_ is new in SCOP 1.59
  
• d1gl0i_ appears in SCOP 1.61
  
• d1gl0i_ appears in the current release, SCOPe 2.08