Lineage for d1gl0i_ (1gl0 I:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2583506Fold g.4: PMP inhibitors [57282] (1 superfamily)
    disulfide-rich fold; all-beta: 3 antiparallel strands
  4. 2583507Superfamily g.4.1: PMP inhibitors [57283] (1 family) (S)
    automatically mapped to Pfam PF05375
  5. 2583508Family g.4.1.1: PMP inhibitors [57284] (5 proteins)
  6. 2583515Protein Protease inhibitor PMP-D2V [69943] (1 species)
  7. 2583516Species Migratory locust (Locusta migratoria) [TaxId:7004] [69944] (1 PDB entry)
  8. 2583517Domain d1gl0i_: 1gl0 I: [65271]
    Other proteins in same PDB: d1gl0e_
    complexed with cd

Details for d1gl0i_

PDB Entry: 1gl0 (more details), 3 Å

PDB Description: structure of the complex between bovine alpha-chymotrypsin and pmp-d2v, an inhibitor from the insect locusta migratoria
PDB Compounds: (I:) protease inhibitor lcmi I

SCOPe Domain Sequences for d1gl0i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gl0i_ g.4.1.1 (I:) Protease inhibitor PMP-D2V {Migratory locust (Locusta migratoria) [TaxId: 7004]}
kctpgqvkqqdcntctctptgvwgctlmgcqp

SCOPe Domain Coordinates for d1gl0i_:

Click to download the PDB-style file with coordinates for d1gl0i_.
(The format of our PDB-style files is described here.)

Timeline for d1gl0i_: