Class g: Small proteins [56992] (90 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (7 families) |
Family g.3.11.1: EGF-type module [57197] (23 proteins) |
Protein E-selectin, EGF-domain [57203] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57204] (5 PDB entries) |
Domain d1g1ra2: 1g1r A:119-160 [65093] Other proteins in same PDB: d1g1ra1, d1g1rb1, d1g1rc1, d1g1rd1 complexed with ca, mrd |
PDB Entry: 1g1r (more details), 3.4 Å
SCOPe Domain Sequences for d1g1ra2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g1ra2 g.3.11.1 (A:119-160) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} tascqdmscskqgecletignytcscypgfygpeceyvrddd
Timeline for d1g1ra2: