SCOP 1.69: Domain d1f5ep_: 1f5e P:

Lineage for d1f5ep_ (1f5e P:)

1. Root: SCOP 1.69

2. Class g: Small proteins [56992] (75 folds)

3. Fold g.38: Zn2/Cys6 DNA-binding domain [57700] (1 superfamily)
   all-alpha dimetal(zinc)-bound fold

4. Superfamily g.38.1: Zn2/Cys6 DNA-binding domain [57701] (1 family)
   duplication: two structural repeats are related by the pseudo dyad

5. Family g.38.1.1: Zn2/Cys6 DNA-binding domain [57702] (6 proteins)

6. Protein Ethanol regulon transcriptional activator ALCR DNA-binding domain [57713] (1 species)

7. Species Aspergillus nidulans and Emericella nidulans [57714] (4 PDB entries)

8. Domain d1f5ep_: 1f5e P: [64985]

Details for d1f5ep_

PDB Entry: 1f5e

PDB Description: structure of transcriptional factor alcr in complex with a target dna

SCOP Domain Sequences for d1f5ep_:

Sequence; same for both SEQRES and ATOM records:

>d1f5ep_ g.38.1.1 (P:) Ethanol regulon transcriptional activator ALCR DNA-binding domain {Aspergillus nidulans and Emericella nidulans}
gsmadtrrrqnhscdpcrkgkrrcdapenrneanengwvscsnckrwnkdctfnwlssqr
sknss

Timeline for d1f5ep_:

• d1f5ep_ first appeared in SCOP 1.59
  
• d1f5ep_ appears in SCOP 1.67
  
• d1f5ep_ appears in SCOP 1.71
  
• d1f5ep_ appears in the current release, SCOPe 2.08