| Class g: Small proteins [56992] (79 folds) |
| Fold g.38: Zn2/Cys6 DNA-binding domain [57700] (1 superfamily) all-alpha dimetal(zinc)-bound fold |
Superfamily g.38.1: Zn2/Cys6 DNA-binding domain [57701] (1 family) ![]() duplication: two structural repeats are related by the pseudo dyad |
| Family g.38.1.1: Zn2/Cys6 DNA-binding domain [57702] (6 proteins) |
| Protein Ethanol regulon transcriptional activator ALCR DNA-binding domain [57713] (1 species) |
| Species Aspergillus nidulans and Emericella nidulans [57714] (4 PDB entries) |
| Domain d1f5ep_: 1f5e P: [64985] complexed with zn; mutant |
PDB Entry: 1f5e (more details)
SCOP Domain Sequences for d1f5ep_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f5ep_ g.38.1.1 (P:) Ethanol regulon transcriptional activator ALCR DNA-binding domain {Aspergillus nidulans and Emericella nidulans}
gsmadtrrrqnhscdpcrkgkrrcdapenrneanengwvscsnckrwnkdctfnwlssqr
sknss
Timeline for d1f5ep_: