Lineage for d1f5ep_ (1f5e P:)

  1. Root: SCOP 1.67
  2. 427008Class g: Small proteins [56992] (72 folds)
  3. 429881Fold g.38: Zn2/Cys6 DNA-binding domain [57700] (1 superfamily)
    all-alpha dimetal(zinc)-bound fold
  4. 429882Superfamily g.38.1: Zn2/Cys6 DNA-binding domain [57701] (1 family) (S)
    duplication: two structural repeats are related by the pseudo dyad
  5. 429883Family g.38.1.1: Zn2/Cys6 DNA-binding domain [57702] (6 proteins)
  6. 429887Protein Ethanol regulon transcriptional activator ALCR DNA-binding domain [57713] (1 species)
  7. 429888Species Aspergillus nidulans and Emericella nidulans [57714] (4 PDB entries)
  8. 429891Domain d1f5ep_: 1f5e P: [64985]
    complexed with zn; mutant

Details for d1f5ep_

PDB Entry: 1f5e (more details)

PDB Description: structure of transcriptional factor alcr in complex with a target dna

SCOP Domain Sequences for d1f5ep_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f5ep_ g.38.1.1 (P:) Ethanol regulon transcriptional activator ALCR DNA-binding domain {Aspergillus nidulans and Emericella nidulans}
gsmadtrrrqnhscdpcrkgkrrcdapenrneanengwvscsnckrwnkdctfnwlssqr
sknss

SCOP Domain Coordinates for d1f5ep_:

Click to download the PDB-style file with coordinates for d1f5ep_.
(The format of our PDB-style files is described here.)

Timeline for d1f5ep_: