Lineage for d1eb6a_ (1eb6 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2204982Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2204983Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2206000Family d.92.1.12: Fungal zinc peptidase [64335] (1 protein)
    single domain with insertions in the common fold
  6. 2206001Protein Fungal zinc peptidase [64336] (2 species)
  7. 2206002Species Aspergillus oryzae, deuterolysin [TaxId:5062] [69774] (1 PDB entry)
  8. 2206003Domain d1eb6a_: 1eb6 A: [64895]
    complexed with edo, zn

Details for d1eb6a_

PDB Entry: 1eb6 (more details), 1 Å

PDB Description: deuterolysin from aspergillus oryzae
PDB Compounds: (A:) neutral protease II

SCOPe Domain Sequences for d1eb6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eb6a_ d.92.1.12 (A:) Fungal zinc peptidase {Aspergillus oryzae, deuterolysin [TaxId: 5062]}
tevtdckgdaesslttalsnaaklanqaaeaaesgdeskfeeyfkttdqqtrttvaerlr
avakeagstsggsttyhcndpygycepnvlaytlpskneiancdiyyselpplaqkchaq
dqatttlhefthapgvyqpgtedlgygydaatqlsaqdalnnadsyalyanaielkc

SCOPe Domain Coordinates for d1eb6a_:

Click to download the PDB-style file with coordinates for d1eb6a_.
(The format of our PDB-style files is described here.)

Timeline for d1eb6a_: