![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) ![]() |
![]() | Family d.92.1.12: Fungal zinc peptidase [64335] (1 protein) single domain with insertions in the common fold |
![]() | Protein Fungal zinc peptidase [64336] (2 species) |
![]() | Species Aspergillus oryzae, deuterolysin [TaxId:5062] [69774] (1 PDB entry) |
![]() | Domain d1eb6a_: 1eb6 A: [64895] complexed with edo, zn |
PDB Entry: 1eb6 (more details), 1 Å
SCOPe Domain Sequences for d1eb6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eb6a_ d.92.1.12 (A:) Fungal zinc peptidase {Aspergillus oryzae, deuterolysin [TaxId: 5062]} tevtdckgdaesslttalsnaaklanqaaeaaesgdeskfeeyfkttdqqtrttvaerlr avakeagstsggsttyhcndpygycepnvlaytlpskneiancdiyyselpplaqkchaq dqatttlhefthapgvyqpgtedlgygydaatqlsaqdalnnadsyalyanaielkc
Timeline for d1eb6a_: