PDB entry 1eb6

View 1eb6 on RCSB PDB site
Description: deuterolysin from aspergillus oryzae
Class: hydrolase
Keywords: metalloproteinase, zinc, neutral protease II, hydrolase
Deposited on 2001-07-19, released 2001-11-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1 Å
R-factor: 0.104
AEROSPACI score: 1.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neutral protease II
    Species: Aspergillus oryzae [TaxId:5062]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1eb6a_
  • Heterogens: ZN, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eb6A (A:)
    tevtdckgdaesslttalsnaaklanqaaeaaesgdeskfeeyfkttdqqtrttvaerlr
    avakeagstsggsttyhcndpygycepnvlaytlpskneiancdiyyselpplaqkchaq
    dqatttlhefthapgvyqpgtedlgygydaatqlsaqdalnnadsyalyanaielkc