Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) |
Family d.92.1.12: Fungal zinc peptidase [64335] (1 protein) single domain with insertions in the common fold |
Protein Fungal zinc peptidase [64336] (2 species) |
Species Aspergillus oryzae, deuterolysin [TaxId:5062] [69774] (1 PDB entry) |
Domain d1eb6a_: 1eb6 A: [64895] complexed with edo, zn |
PDB Entry: 1eb6 (more details), 1 Å
SCOPe Domain Sequences for d1eb6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eb6a_ d.92.1.12 (A:) Fungal zinc peptidase {Aspergillus oryzae, deuterolysin [TaxId: 5062]} tevtdckgdaesslttalsnaaklanqaaeaaesgdeskfeeyfkttdqqtrttvaerlr avakeagstsggsttyhcndpygycepnvlaytlpskneiancdiyyselpplaqkchaq dqatttlhefthapgvyqpgtedlgygydaatqlsaqdalnnadsyalyanaielkc
Timeline for d1eb6a_: