Lineage for d1e9fa_ (1e9f A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2109205Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 protein domains)
    parallel beta-sheet of 5 strands, order 23145
  6. 2109670Protein Thymidylate kinase [52563] (4 species)
  7. 2109687Species Human (Homo sapiens) [TaxId:9606] [64010] (20 PDB entries)
  8. 2109707Domain d1e9fa_: 1e9f A: [64811]
    complexed with adp, mg, tmp; mutant

Details for d1e9fa_

PDB Entry: 1e9f (more details), 1.9 Å

PDB Description: mutant human thymidylate kinase complexed with tmp and adp
PDB Compounds: (A:) thymidylate kinase

SCOPe Domain Sequences for d1e9fa_:

Sequence, based on SEQRES records: (download)

>d1e9fa_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]}
rrgalivlegvdgagkstqsrklvealcaaghraellrfpersteigkllssylqkksdv
edhsvhllfsanrweqvplikeklsqgvtlvvdryafsgvaftgakenfsldwckqpdvg
lpkpdlvlflqlqladaakrgrargeleryengafqeralrcfhqlmkdttlnwkmvdas
ksieavhedirvlsedaiatatekplgelwk

Sequence, based on observed residues (ATOM records): (download)

>d1e9fa_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]}
rrgalivlegvdgagkstqsrklvealcaaghraellrfpersteigkllssylqkksdv
edhsvhllfsanrweqvplikeklsqgvtlvvdryafsgvaftgakenfsldwckqpdvg
lpkpdlvlflqlqladaakryengafqeralrcfhqlmkdttlnwkmvdasksieavhed
irvlsedaiatatekplgelwk

SCOPe Domain Coordinates for d1e9fa_:

Click to download the PDB-style file with coordinates for d1e9fa_.
(The format of our PDB-style files is described here.)

Timeline for d1e9fa_: