Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins) parallel beta-sheet of 5 strands, order 23145 |
Protein Thymidylate kinase [52563] (5 species) |
Species Human (Homo sapiens) [TaxId:9606] [64010] (20 PDB entries) |
Domain d1e9fa_: 1e9f A: [64811] complexed with adp, mg, tmp; mutant |
PDB Entry: 1e9f (more details), 1.9 Å
SCOPe Domain Sequences for d1e9fa_:
Sequence, based on SEQRES records: (download)
>d1e9fa_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} rrgalivlegvdgagkstqsrklvealcaaghraellrfpersteigkllssylqkksdv edhsvhllfsanrweqvplikeklsqgvtlvvdryafsgvaftgakenfsldwckqpdvg lpkpdlvlflqlqladaakrgrargeleryengafqeralrcfhqlmkdttlnwkmvdas ksieavhedirvlsedaiatatekplgelwk
>d1e9fa_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} rrgalivlegvdgagkstqsrklvealcaaghraellrfpersteigkllssylqkksdv edhsvhllfsanrweqvplikeklsqgvtlvvdryafsgvaftgakenfsldwckqpdvg lpkpdlvlflqlqladaakryengafqeralrcfhqlmkdttlnwkmvdasksieavhed irvlsedaiatatekplgelwk
Timeline for d1e9fa_: