PDB entry 1e9f

View 1e9f on RCSB PDB site
Description: Mutant human thymidylate kinase complexed with TMP and ADP
Class: transferase
Keywords: phosphotransferase, thymidylate kinase, p-loop, transferase
Deposited on 2000-10-11, released 2001-10-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-15, with a file datestamp of 2017-03-10.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thymidylate kinase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23919 (Start-216)
      • engineered mutation (204)
      • engineered mutation (18)
      • conflict (188)
      • conflict (195)
      • conflict (194)
      • conflict (187)
    • Uniprot P37345
    Domains in SCOPe 2.07: d1e9fa_
  • Heterogens: TMP, ADP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e9fA (A:)
    gshmaarrgalivlegvdgagkstqsrklvealcaaghraellrfpersteigkllssyl
    qkksdvedhsvhllfsanrweqvplikeklsqgvtlvvdryafsgvaftgakenfsldwc
    kqpdvglpkpdlvlflqlqladaakrgrargeleryengafqeralrcfhqlmkdttlnw
    kmvdasksieavhedirvlsedaiatatekplgelwk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e9fA (A:)
    rrgalivlegvdgagkstqsrklvealcaaghraellrfpersteigkllssylqkksdv
    edhsvhllfsanrweqvplikeklsqgvtlvvdryafsgvaftgakenfsldwckqpdvg
    lpkpdlvlflqlqladaakryengafqeralrcfhqlmkdttlnwkmvdasksieavhed
    irvlsedaiatatekplgelwk