SCOPe 2.08: Domain d1dl5b1: 1dl5 B:1-213

Lineage for d1dl5b1 (1dl5 B:1-213)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families)

5. Family c.66.1.7: Protein-L-isoaspartyl O-methyltransferase [53354] (1 protein)
   topological variant; strand order 3214567; strand 6 is antiparallel to the rest
   automatically mapped to Pfam PF01135

6. Protein Protein-L-isoaspartyl O-methyltransferase [68927] (5 species)

7. Species Thermotoga maritima [TaxId:2336] [68928] (1 PDB entry)

8. Domain d1dl5b1: 1dl5 B:1-213 [64722]
   Other proteins in same PDB: d1dl5a2, d1dl5b2
   complexed with cd, cl, sah

Details for d1dl5b1

PDB Entry: 1dl5, 1.8 Å

PDB Description: protein-l-isoaspartate o-methyltransferase

PDB Compounds: (B:) protein-l-isoaspartate o-methyltransferase

SCOPe Domain Sequences for d1dl5b1:

Sequence; same for both SEQRES and ATOM records:

>d1dl5b1 c.66.1.7 (B:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]}
mreklfwilkkygvsdhiakafleipreefltksyplsyvyedivlvsyddgeeystssq
pslmalfmewvgldkgmrvleigggtgynaavmsrvvgekglvvsveysrkiceiakrnv
erlgienvifvcgdgyygvpefspydvifvtvgvdevpetwftqlkeggrvivpinlkls
rrqpaflfkkkdpylvgnykletrfitaggnlg

Timeline for d1dl5b1:

• d1dl5b1 first appeared in SCOP 1.59
  
• d1dl5b1 appears in SCOPe 2.07