![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) ![]() |
![]() | Family c.66.1.7: Protein-L-isoaspartyl O-methyltransferase [53354] (1 protein) topological variant; strand order 3214567; strand 6 is antiparallel to the rest automatically mapped to Pfam PF01135 |
![]() | Protein Protein-L-isoaspartyl O-methyltransferase [68927] (5 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [68928] (1 PDB entry) |
![]() | Domain d1dl5b1: 1dl5 B:1-213 [64722] Other proteins in same PDB: d1dl5a2, d1dl5b2 complexed with cd, cl, sah |
PDB Entry: 1dl5 (more details), 1.8 Å
SCOPe Domain Sequences for d1dl5b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dl5b1 c.66.1.7 (B:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} mreklfwilkkygvsdhiakafleipreefltksyplsyvyedivlvsyddgeeystssq pslmalfmewvgldkgmrvleigggtgynaavmsrvvgekglvvsveysrkiceiakrnv erlgienvifvcgdgyygvpefspydvifvtvgvdevpetwftqlkeggrvivpinlkls rrqpaflfkkkdpylvgnykletrfitaggnlg
Timeline for d1dl5b1: