PDB entry 1dl5

View 1dl5 on RCSB PDB site
Description: protein-l-isoaspartate o-methyltransferase
Class: transferase
Keywords: methyltransferase, isoaspartyl residues, protein repair, deamidation, post-translational modification
Deposited on 1999-12-08, released 2000-12-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.182
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein-l-isoaspartate o-methyltransferase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dl5a1, d1dl5a2
  • Chain 'B':
    Compound: protein-l-isoaspartate o-methyltransferase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dl5b1, d1dl5b2
  • Heterogens: CD, CL, SAH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dl5A (A:)
    mreklfwilkkygvsdhiakafleipreefltksyplsyvyedivlvsyddgeeystssq
    pslmalfmewvgldkgmrvleigggtgynaavmsrvvgekglvvsveysrkiceiakrnv
    erlgienvifvcgdgyygvpefspydvifvtvgvdevpetwftqlkeggrvivpinlkls
    rrqpaflfkkkdpylvgnykletrfitaggnlgnllernrkllrefpfnreillvrshif
    velvdlltrrlteidgtfyyagpngvveflddrmriygdapeienlltqwescgyrsfey
    lmlhvgynafshiscsi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dl5B (B:)
    mreklfwilkkygvsdhiakafleipreefltksyplsyvyedivlvsyddgeeystssq
    pslmalfmewvgldkgmrvleigggtgynaavmsrvvgekglvvsveysrkiceiakrnv
    erlgienvifvcgdgyygvpefspydvifvtvgvdevpetwftqlkeggrvivpinlkls
    rrqpaflfkkkdpylvgnykletrfitaggnlgnllernrkllrefpfnreillvrshif
    velvdlltrrlteidgtfyyagpngvveflddrmriygdapeienlltqwescgyrsfey
    lmlhvgynafshiscsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dl5B (B:)
    mreklfwilkkygvsdhiakafleipreefltksyplsyvyedivlvsyddgeeystssq
    pslmalfmewvgldkgmrvleigggtgynaavmsrvvgekglvvsveysrkiceiakrnv
    erlgienvifvcgdgyygvpefspydvifvtvgvdevpetwftqlkeggrvivpinlkls
    rrqpaflfkkkdpylvgnykletrfitaggnlgnllernrkllrefpfnreillvrshif
    velvdlltrrlteidgtfyyagpngvveflddrmriygdapeienlltqwescgyrsfey
    lmlhvgynafshiscs