Lineage for d1dl5a2 (1dl5 A:214-317)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.197: Protein-L-isoaspartyl O-methyltransferase, C-terminal domain [68929] (1 superfamily)
    beta-alpha-beta(4)-alpha-beta(2); 3 layers: beta/alpha/beta; buried helix
  4. Superfamily d.197.1: Protein-L-isoaspartyl O-methyltransferase, C-terminal domain [68930] (1 family) (S)
  5. Family d.197.1.1: Protein-L-isoaspartyl O-methyltransferase, C-terminal domain [68931] (1 protein)
  6. Protein Protein-L-isoaspartyl O-methyltransferase, C-terminal domain [68932] (1 species)
  7. Species Thermotoga maritima [TaxId:2336] [53356] (1 PDB entry)
  8. Domain d1dl5a2: 1dl5 A:214-317 [64721]
    Other proteins in same PDB: d1dl5a1, d1dl5b1
    complexed with cd, cl, sah

Details for d1dl5a2

PDB Entry: 1dl5 (more details), 1.8 Å

PDB Description: protein-l-isoaspartate o-methyltransferase
PDB Compounds: (A:) protein-l-isoaspartate o-methyltransferase

SCOPe Domain Sequences for d1dl5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dl5a2 d.197.1.1 (A:214-317) Protein-L-isoaspartyl O-methyltransferase, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
nllernrkllrefpfnreillvrshifvelvdlltrrlteidgtfyyagpngvveflddr
mriygdapeienlltqwescgyrsfeylmlhvgynafshiscsi

SCOPe Domain Coordinates for d1dl5a2 are not available.

Timeline for d1dl5a2:

Domains from same chain:
(mouse over for more information)
d1dl5a1
Domains from other chains:
(mouse over for more information)
d1dl5b1, d1dl5b2