SCOPe 2.07: Domain d1jr3c2: 1jr3 C:3-242

Lineage for d1jr3c2 (1jr3 C:3-242)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.20: Extended AAA-ATPase domain [81269] (42 proteins)
   fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain

6. Protein gamma subunit of DNA polymerase III, N-domain [64031] (2 species)

7. Species Escherichia coli [TaxId:562] [64032] (3 PDB entries)
   Uniprot P06710 5-368

8. Domain d1jr3c2: 1jr3 C:3-242 [63250]
   Other proteins in same PDB: d1jr3a1, d1jr3b1, d1jr3c1, d1jr3d1, d1jr3d2, d1jr3e1, d1jr3e2
   protein/DNA complex; complexed with so4, zn

Details for d1jr3c2

PDB Entry: 1jr3, 2.7 Å

PDB Description: crystal structure of the processivity clamp loader gamma complex of e. coli dna polymerase iii

PDB Compounds: (C:) DNA polymerase III subunit gamma

SCOPe Domain Sequences for d1jr3c2:

Sequence; same for both SEQRES and ATOM records:

>d1jr3c2 c.37.1.20 (C:3-242) gamma subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}
yqvlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgktsiarllakgl
ncetgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqyapargrfkv
ylidevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqfhlkaldveq
irhqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvstqavsamlg

Timeline for d1jr3c2:

• d1jr3c2 first appeared in SCOP 1.57
  
• d1jr3c2 appears in SCOPe 2.06
  
• d1jr3c2 appears in the current release, SCOPe 2.08