Lineage for d1jr3c2 (1jr3 C:3-242)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870969Family c.37.1.20: Extended AAA-ATPase domain [81269] (43 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 2871074Protein gamma subunit of DNA polymerase III, N-domain [64031] (2 species)
  7. 2871075Species Escherichia coli [TaxId:562] [64032] (3 PDB entries)
    Uniprot P06710 5-368
  8. 2871078Domain d1jr3c2: 1jr3 C:3-242 [63250]
    Other proteins in same PDB: d1jr3a1, d1jr3b1, d1jr3c1, d1jr3d1, d1jr3d2, d1jr3e1, d1jr3e2
    protein/DNA complex; complexed with so4, zn

Details for d1jr3c2

PDB Entry: 1jr3 (more details), 2.7 Å

PDB Description: crystal structure of the processivity clamp loader gamma complex of e. coli dna polymerase iii
PDB Compounds: (C:) DNA polymerase III subunit gamma

SCOPe Domain Sequences for d1jr3c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jr3c2 c.37.1.20 (C:3-242) gamma subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}
yqvlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgktsiarllakgl
ncetgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqyapargrfkv
ylidevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqfhlkaldveq
irhqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvstqavsamlg

SCOPe Domain Coordinates for d1jr3c2:

Click to download the PDB-style file with coordinates for d1jr3c2.
(The format of our PDB-style files is described here.)

Timeline for d1jr3c2: