Lineage for d1jr3d1 (1jr3 D:212-338)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332241Fold a.80: post-AAA+ oligomerization domain-like [48018] (1 superfamily)
    core: 5 helices: bundle
  4. 2332242Superfamily a.80.1: post-AAA+ oligomerization domain-like [48019] (2 families) (S)
    associated with N-terminal domain from the AAA+ family of P-loop hydrolases
  5. 2332243Family a.80.1.1: DNA polymerase III clamp loader subunits, C-terminal domain [48020] (9 proteins)
    contains an extra helix
  6. 2332252Protein delta subunit [63580] (1 species)
  7. 2332253Species Escherichia coli [TaxId:562] [63581] (4 PDB entries)
    Uniprot P28630
  8. 2332254Domain d1jr3d1: 1jr3 D:212-338 [63251]
    Other proteins in same PDB: d1jr3a1, d1jr3a2, d1jr3b1, d1jr3b2, d1jr3c1, d1jr3c2, d1jr3d2, d1jr3e1, d1jr3e2
    protein/DNA complex; complexed with so4, zn

Details for d1jr3d1

PDB Entry: 1jr3 (more details), 2.7 Å

PDB Description: crystal structure of the processivity clamp loader gamma complex of e. coli dna polymerase iii
PDB Compounds: (D:) DNA Polymerase III, DELTA SUBUNIT

SCOPe Domain Sequences for d1jr3d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jr3d1 a.80.1.1 (D:212-338) delta subunit {Escherichia coli [TaxId: 562]}
ftpfhwvdallmgkskralhilqqlrlegsepvillrtlqrellllvnlkrqsahtplra
lfdkhrvwqnrrgmmgealnrlsqtqlrqavqlltrteltlkqdygqsvwaeleglslll
chkplad

SCOPe Domain Coordinates for d1jr3d1:

Click to download the PDB-style file with coordinates for d1jr3d1.
(The format of our PDB-style files is described here.)

Timeline for d1jr3d1: