SCOPe 2.08: Domain d1jj2t_: 1jj2 T:

Lineage for d1jj2t_ (1jj2 T:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)

5. Family g.39.1.6: Ribosomal protein L24e [57749] (1 protein)
   automatically mapped to Pfam PF01246

6. Protein Ribosomal protein L24e [57750] (1 species)

7. Species Haloarcula marismortui [TaxId:2238] [57751] (44 PDB entries)
   Uniprot P14116

8. Domain d1jj2t_: 1jj2 T: [63105]
   Other proteins in same PDB: d1jj21_, d1jj22_, d1jj2a1, d1jj2a2, d1jj2b_, d1jj2c_, d1jj2d_, d1jj2e1, d1jj2e2, d1jj2f_, d1jj2g_, d1jj2h_, d1jj2i_, d1jj2j_, d1jj2k_, d1jj2l_, d1jj2m_, d1jj2n_, d1jj2o_, d1jj2p_, d1jj2q_, d1jj2r_, d1jj2s_, d1jj2u_, d1jj2v_, d1jj2w_, d1jj2x_, d1jj2y_, d1jj2z_
   complexed with cd, cl, k, mg, na

Details for d1jj2t_

PDB Entry: 1jj2, 2.4 Å

PDB Description: Fully Refined Crystal Structure of the Haloarcula marismortui Large Ribosomal Subunit at 2.4 Angstrom Resolution

PDB Compounds: (T:) ribosomal protein l24e

SCOPe Domain Sequences for d1jj2t_:

Sequence; same for both SEQRES and ATOM records:

>d1jj2t_ g.39.1.6 (T:) Ribosomal protein L24e {Haloarcula marismortui [TaxId: 2238]}
recdycgtdiepgtgtmfvhkdgatthfcsskcennadlgrearnlewtdtar

Timeline for d1jj2t_:

• d1jj2t_ first appeared in SCOP 1.57
  
• d1jj2t_ appears in SCOPe 2.07