SCOPe 2.08: Domain d1jj2w_: 1jj2 W:

Lineage for d1jj2w_ (1jj2 W:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.29: Ribosomal protein L31e [54574] (1 superfamily)
   beta-alpha-beta-(alpha)-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 1342

4. Superfamily d.29.1: Ribosomal protein L31e [54575] (1 family)
   automatically mapped to Pfam PF01198

5. Family d.29.1.1: Ribosomal protein L31e [54576] (1 protein)

6. Protein Ribosomal protein L31e [54577] (1 species)

7. Species Haloarcula marismortui [TaxId:2238] [54578] (40 PDB entries)
   Uniprot P18138

8. Domain d1jj2w_: 1jj2 W: [63108]
   Other proteins in same PDB: d1jj21_, d1jj22_, d1jj2a1, d1jj2a2, d1jj2b_, d1jj2c_, d1jj2d_, d1jj2e1, d1jj2e2, d1jj2f_, d1jj2g_, d1jj2h_, d1jj2i_, d1jj2j_, d1jj2k_, d1jj2l_, d1jj2m_, d1jj2n_, d1jj2o_, d1jj2p_, d1jj2q_, d1jj2r_, d1jj2s_, d1jj2t_, d1jj2u_, d1jj2v_, d1jj2x_, d1jj2y_, d1jj2z_
   complexed with cd, cl, k, mg, na

Details for d1jj2w_

PDB Entry: 1jj2, 2.4 Å

PDB Description: Fully Refined Crystal Structure of the Haloarcula marismortui Large Ribosomal Subunit at 2.4 Angstrom Resolution

PDB Compounds: (W:) ribosomal protein l31e

SCOPe Domain Sequences for d1jj2w_:

Sequence; same for both SEQRES and ATOM records:

>d1jj2w_ d.29.1.1 (W:) Ribosomal protein L31e {Haloarcula marismortui [TaxId: 2238]}
ervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawargrant
pskirvraarfeeegeaiveae

Timeline for d1jj2w_:

• d1jj2w_ first appeared in SCOP 1.57
  
• d1jj2w_ appears in SCOPe 2.07