SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1jj2o_ (1jj2 O:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2003191Fold a.94: Ribosomal protein L19 (L19e) [48139] (1 superfamily)
    multihelical; consists of two different 3-helical domains connected by a long, partly helical linker
  4. 2003192Superfamily a.94.1: Ribosomal protein L19 (L19e) [48140] (1 family) (S)
    automatically mapped to Pfam PF01280
  5. 2003193Family a.94.1.1: Ribosomal protein L19 (L19e) [48141] (1 protein)
  6. 2003194Protein Ribosomal protein L19 (L19e) [48142] (1 species)
  7. 2003195Species Haloarcula marismortui [TaxId:2238] [48143] (58 PDB entries)
    Uniprot P14119
  8. 2003202Domain d1jj2o_: 1jj2 O: [63100]
    Other proteins in same PDB: d1jj21_, d1jj22_, d1jj2a1, d1jj2a2, d1jj2b_, d1jj2c_, d1jj2d_, d1jj2e1, d1jj2e2, d1jj2f_, d1jj2g_, d1jj2h_, d1jj2i_, d1jj2j_, d1jj2k_, d1jj2l_, d1jj2m_, d1jj2n_, d1jj2p_, d1jj2q_, d1jj2r_, d1jj2s_, d1jj2t_, d1jj2u_, d1jj2v_, d1jj2w_, d1jj2x_, d1jj2y_, d1jj2z_
    complexed with cd, cl, k, mg, na

Details for d1jj2o_

PDB Entry: 1jj2 (more details), 2.4 Å

PDB Description: Fully Refined Crystal Structure of the Haloarcula marismortui Large Ribosomal Subunit at 2.4 Angstrom Resolution
PDB Compounds: (O:) ribosomal protein l19e

SCOPe Domain Sequences for d1jj2o_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jj2o_ a.94.1.1 (O:) Ribosomal protein L19 (L19e) {Haloarcula marismortui [TaxId: 2238]}
tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg
rarerqkkrakghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr
dlydkagggefdsvadleryida

SCOPe Domain Coordinates for d1jj2o_:

Click to download the PDB-style file with coordinates for d1jj2o_.
(The format of our PDB-style files is described here.)

Timeline for d1jj2o_: