SCOP 1.63: Domain d1jfic1: 1jfi C:356-456

Lineage for d1jfic1 (1jfi C:356-456)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.129: TBP-like [55944] (4 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.1: TATA-box binding protein-like [55945] (2 families)

5. Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein)
   duplication: consists of two clear structural repeats

6. Protein TATA-box binding protein (TBP), C-terminal domain [55947] (4 species)
   structure of the N-terminal domain is not known yet

7. Species Human (Homo sapiens) [TaxId:9606] [55948] (4 PDB entries)

8. Domain d1jfic1: 1jfi C:356-456 [62938]
   Other proteins in same PDB: d1jfia_, d1jfib_

Details for d1jfic1

PDB Entry: 1jfi, 2.62 Å

PDB Description: crystal structure of the nc2-tbp-dna ternary complex

SCOP Domain Sequences for d1jfic1:

Sequence; same for both SEQRES and ATOM records:

>d1jfic1 d.129.1.1 (C:356-456) TATA-box binding protein (TBP), C-terminal domain {Human (Homo sapiens)}
shmsgivpqlqnivstvnlgckldlktialrarnaeynpkrfaavimrireprttalifs
sgkmvctgakseeqsrlaarkyarvvqklgfpakfldfkiq

Timeline for d1jfic1:

• d1jfic1 first appeared in SCOP 1.57
  
• d1jfic1 appears in SCOP 1.61
  
• d1jfic1 appears in SCOP 1.65
  
• d1jfic1 appears in the current release, SCOPe 2.08