| Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
| Fold d.129: TBP-like [55944] (4 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.1: TATA-box binding protein-like [55945] (2 families) ![]() |
| Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein) duplication: consists of two clear structural repeats |
| Protein TATA-box binding protein (TBP), C-terminal domain [55947] (4 species) structure of the N-terminal domain is not known yet |
| Species Human (Homo sapiens) [TaxId:9606] [55948] (4 PDB entries) |
| Domain d1jfic1: 1jfi C:356-456 [62938] Other proteins in same PDB: d1jfia_, d1jfib_ |
PDB Entry: 1jfi (more details), 2.62 Å
SCOP Domain Sequences for d1jfic1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jfic1 d.129.1.1 (C:356-456) TATA-box binding protein (TBP), C-terminal domain {Human (Homo sapiens)}
shmsgivpqlqnivstvnlgckldlktialrarnaeynpkrfaavimrireprttalifs
sgkmvctgakseeqsrlaarkyarvvqklgfpakfldfkiq
Timeline for d1jfic1: