SCOPe 2.02: Domain d1jcga1: 1jcg A:1-140

Lineage for d1jcga1 (1jcg A:1-140)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)

6. Protein Prokaryotic actin homolog MreB [64087] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [64088] (3 PDB entries)

8. Domain d1jcga1: 1jcg A:1-140 [62880]
   complexed with anp, mg

Details for d1jcga1

PDB Entry: 1jcg, 3.1 Å

PDB Description: mreb from thermotoga maritima, amppnp

PDB Compounds: (A:) rod shape-determining protein mreb

SCOPe Domain Sequences for d1jcga1:

Sequence; same for both SEQRES and ATOM records:

>d1jcga1 c.55.1.1 (A:1-140) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]}
mlrkdigidlgtantlvflrgkgivvnepsviaidsttgeilkvgleaknmigktpatik
airpmrdgviadytvalvmlryfinkakggmnlfkprvvigvpigitdverraildagle
agaskvflieepmaaaigsn

Timeline for d1jcga1:

• d1jcga1 first appeared in SCOP 1.57
  
• d1jcga1 appears in SCOPe 2.01
  
• d1jcga1 appears in SCOPe 2.03
  
• d1jcga1 appears in the current release, SCOPe 2.08