![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.1: Actin/HSP70 [53068] (7 proteins) |
![]() | Protein Prokaryotic actin homolog MreB [64087] (1 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [64088] (3 PDB entries) |
![]() | Domain d1jcga2: 1jcg A:141-335 [62881] complexed with anp, mg |
PDB Entry: 1jcg (more details), 3.1 Å
SCOPe Domain Sequences for d1jcga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jcga2 c.55.1.1 (A:141-335) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} lnveepsgnmvvdigggttevavislgsivtwesiriagdemdeaivqyvretyrvaige rtaervkieignvfpskendelettvsgidlstglprkltlkggevrealrsvvvaives vrttlektppelvsdiiergifltgggsllrgldtllqketgisvirseepltavakgag mvldkvnilkklqga
Timeline for d1jcga2: