Lineage for d1jcga1 (1jcg A:1-140)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 71788Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 71789Superfamily c.55.1: Actin-like ATPase domain [53067] (5 families) (S)
  5. 71790Family c.55.1.1: Actin/HSP70 [53068] (4 proteins)
  6. 71889Protein Prokaryotic actin homolog MreB [64087] (1 species)
  7. 71890Species Thermotoga maritima [TaxId:243274] [64088] (3 PDB entries)
  8. 71895Domain d1jcga1: 1jcg A:1-140 [62880]

Details for d1jcga1

PDB Entry: 1jcg (more details), 3.1 Å

PDB Description: mreb from thermotoga maritima, amppnp

SCOP Domain Sequences for d1jcga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jcga1 c.55.1.1 (A:1-140) Prokaryotic actin homolog MreB {Thermotoga maritima}
mlrkdigidlgtantlvflrgkgivvnepsviaidsttgeilkvgleaknmigktpatik
airpmrdgviadytvalvmlryfinkakggmnlfkprvvigvpigitdverraildagle
agaskvflieepmaaaigsn

SCOP Domain Coordinates for d1jcga1:

Click to download the PDB-style file with coordinates for d1jcga1.
(The format of our PDB-style files is described here.)

Timeline for d1jcga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jcga2