Lineage for d1jb0d_ (1jb0 D:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1684929Fold d.187: Photosystem I subunit PsaD [64233] (1 superfamily)
    beta-BETA(2)-beta-alpha-beta(2); antiparallel sheet: order 2134 packed against helix and BETA-hairpin on the same side; irregular C-terminal tail
  4. 1684930Superfamily d.187.1: Photosystem I subunit PsaD [64234] (1 family) (S)
    automatically mapped to Pfam PF02531
  5. 1684931Family d.187.1.1: Photosystem I subunit PsaD [64235] (2 proteins)
  6. 1684932Protein Photosystem I subunit PsaD [64236] (1 species)
  7. 1684933Species Synechococcus elongatus [TaxId:32046] [64237] (1 PDB entry)
  8. 1684934Domain d1jb0d_: 1jb0 D: [62823]
    Other proteins in same PDB: d1jb0a_, d1jb0b_, d1jb0c_, d1jb0e_, d1jb0f_, d1jb0i_, d1jb0j_, d1jb0k_, d1jb0l_, d1jb0m_, d1jb0x_
    complexed with bcr, ca, cla, lhg, lmg, pqn, sf4

Details for d1jb0d_

PDB Entry: 1jb0 (more details), 2.5 Å

PDB Description: crystal structure of photosystem i: a photosynthetic reaction center and core antenna system from cyanobacteria
PDB Compounds: (D:) photosystem 1 reaction centre subunit II

SCOPe Domain Sequences for d1jb0d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jb0d_ d.187.1.1 (D:) Photosystem I subunit PsaD {Synechococcus elongatus [TaxId: 32046]}
ttltgqpplyggstggllsaadteekyaitwtspkeqvfemptagaavmregenlvyfar
keqclalaaqqlrprkindykiyrifpdgetvlihpkdgvfpekvnkgreavnsvprsig
qnpnpsqlkftgkkpydp

SCOPe Domain Coordinates for d1jb0d_:

Click to download the PDB-style file with coordinates for d1jb0d_.
(The format of our PDB-style files is described here.)

Timeline for d1jb0d_: