Lineage for d1jb0f_ (1jb0 F:)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1697651Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1698490Superfamily f.23.16: Subunit III of photosystem I reaction centre, PsaF [81536] (1 family) (S)
    automatically mapped to Pfam PF02507
  5. 1698491Family f.23.16.1: Subunit III of photosystem I reaction centre, PsaF [81535] (2 proteins)
  6. 1698492Protein Subunit III of photosystem I reaction centre, PsaF [81534] (1 species)
  7. 1698493Species Synechococcus elongatus [TaxId:32046] [81533] (1 PDB entry)
  8. 1698494Domain d1jb0f_: 1jb0 F: [62825]
    Other proteins in same PDB: d1jb0a_, d1jb0b_, d1jb0c_, d1jb0d_, d1jb0e_, d1jb0i_, d1jb0j_, d1jb0k_, d1jb0l_, d1jb0m_, d1jb0x_
    complexed with bcr, ca, cla, lhg, lmg, pqn, sf4

Details for d1jb0f_

PDB Entry: 1jb0 (more details), 2.5 Å

PDB Description: crystal structure of photosystem i: a photosynthetic reaction center and core antenna system from cyanobacteria
PDB Compounds: (F:) photosystem 1 reaction centre subunit III

SCOPe Domain Sequences for d1jb0f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jb0f_ f.23.16.1 (F:) Subunit III of photosystem I reaction centre, PsaF {Synechococcus elongatus [TaxId: 32046]}
dvaglvpckdspafqkraaaavnttadpasgqkrferysqalcgedglphlvvdgrlsra
gdflipsvlflyiagwigwvgrayliavrnsgeanekeiiidvplaikcmltgfawplaa
lkelasgeltakdneitvspr

SCOPe Domain Coordinates for d1jb0f_:

Click to download the PDB-style file with coordinates for d1jb0f_.
(The format of our PDB-style files is described here.)

Timeline for d1jb0f_: