![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.187: Photosystem I subunit PsaD [64233] (1 superfamily) beta-BETA(2)-beta-alpha-beta(2); antiparallel sheet: order 2134 packed against helix and BETA-hairpin on the same side; irregular C-terminal tail |
![]() | Superfamily d.187.1: Photosystem I subunit PsaD [64234] (1 family) ![]() automatically mapped to Pfam PF02531 |
![]() | Family d.187.1.1: Photosystem I subunit PsaD [64235] (2 proteins) |
![]() | Protein Photosystem I subunit PsaD [64236] (2 species) |
![]() | Species Synechococcus elongatus [TaxId:32046] [64237] (1 PDB entry) |
![]() | Domain d1jb0d_: 1jb0 D: [62823] Other proteins in same PDB: d1jb0a_, d1jb0b_, d1jb0c_, d1jb0e_, d1jb0f_, d1jb0i_, d1jb0j_, d1jb0k_, d1jb0l_, d1jb0m_, d1jb0x1, d1jb0x2 complexed with bcr, ca, cla, lhg, lmg, pqn, sf4 |
PDB Entry: 1jb0 (more details), 2.5 Å
SCOPe Domain Sequences for d1jb0d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jb0d_ d.187.1.1 (D:) Photosystem I subunit PsaD {Synechococcus elongatus [TaxId: 32046]} ttltgqpplyggstggllsaadteekyaitwtspkeqvfemptagaavmregenlvyfar keqclalaaqqlrprkindykiyrifpdgetvlihpkdgvfpekvnkgreavnsvprsig qnpnpsqlkftgkkpydp
Timeline for d1jb0d_: