| Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.18: Subunit IX of photosystem I reaction centre, PsaJ [81544] (2 families) ![]() automatically mapped to Pfam PF01701 |
| Family f.23.18.1: Subunit IX of photosystem I reaction centre, PsaJ [81543] (2 proteins) |
| Protein Subunit IX of photosystem I reaction centre, PsaJ [81542] (2 species) |
| Species Synechococcus elongatus [TaxId:32046] [81541] (1 PDB entry) |
| Domain d1jb0j_: 1jb0 J: [62827] Other proteins in same PDB: d1jb0a_, d1jb0b_, d1jb0c_, d1jb0d_, d1jb0e_, d1jb0f_, d1jb0i_, d1jb0k_, d1jb0l_, d1jb0m_, d1jb0x1, d1jb0x2 complexed with bcr, ca, cla, lhg, lmg, pqn, sf4 |
PDB Entry: 1jb0 (more details), 2.5 Å
SCOPe Domain Sequences for d1jb0j_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jb0j_ f.23.18.1 (J:) Subunit IX of photosystem I reaction centre, PsaJ {Synechococcus elongatus [TaxId: 32046]}
mkhfltylstapvlaaiwmtitagiliefnrfypdllfhpl
Timeline for d1jb0j_: