SCOP 1.63: Domain d1j7vl_: 1j7v L:

Lineage for d1j7vl_ (1j7v L:)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (3 families)
   there are two different topoisomers of this fold with different entanglments of the two crossover connections

5. Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (7 proteins)
   contains an additional helix in one of the crossover connections

6. Protein Interleukin-10 (cytokine synthesis inhibitory factor, CSIF) [47306] (3 species)
   intertwined dimer, similar to interferon-gamma

7. Species Human (Homo sapiens) [TaxId:9606] [47307] (5 PDB entries)

8. Domain d1j7vl_: 1j7v L: [62704]
   Other proteins in same PDB: d1j7vr1, d1j7vr2
   complexed with IL-10 receptor 1 (IL-10R1)
   mutant

Details for d1j7vl_

PDB Entry: 1j7v, 2.9 Å

PDB Description: human il-10 / il-10r1 complex

SCOP Domain Sequences for d1j7vl_:

Sequence; same for both SEQRES and ATOM records:

>d1j7vl_ a.26.1.3 (L:) Interleukin-10 (cytokine synthesis inhibitory factor, CSIF) {Human (Homo sapiens)}
scthfpgnlpnmlrdlrdafsrvktffqmkdqldnlllkeslledfkgylgcqalsemiq
fyleevmpqaenqdpdikahvnslgenlktlrlrlrrchrflpcenkskaveqvknafnk
lqekgiykamsefdifinyieaymtmkirn

Timeline for d1j7vl_:

• d1j7vl_ first appeared in SCOP 1.57
  
• d1j7vl_ appears in SCOP 1.61
  
• d1j7vl_ appears in SCOP 1.65
  
• d1j7vl_ appears in the current release, SCOPe 2.08