Lineage for d1iodb_ (1iod B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1682071Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1682072Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1682073Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 1682418Protein Snake coagglutinin beta chain [88867] (10 species)
    heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)
  7. 1682444Species Sharp-nosed viper (Deinagkistrodon acutus) [TaxId:36307] [88871] (3 PDB entries)
  8. 1682447Domain d1iodb_: 1iod B: [62623]
    Other proteins in same PDB: d1ioda_, d1iodg_
    complexed with ca

Details for d1iodb_

PDB Entry: 1iod (more details), 2.3 Å

PDB Description: crystal structure of the complex between the coagulation factor x binding protein from snake venom and the gla domain of factor x
PDB Compounds: (B:) coagulation factor x binding protein

SCOPe Domain Sequences for d1iodb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iodb_ d.169.1.1 (B:) Snake coagglutinin beta chain {Sharp-nosed viper (Deinagkistrodon acutus) [TaxId: 36307]}
dcpsdwssyeghcykpfnepknwadaenfctqqhtgshlvsfqsteeadfvvklafqtfd
ygifwmglskiwnqcnwqwsnaamlkytdwaeesycvyfkstnnkwrsitcrmianfvce
fqa

SCOPe Domain Coordinates for d1iodb_:

Click to download the PDB-style file with coordinates for d1iodb_.
(The format of our PDB-style files is described here.)

Timeline for d1iodb_: