Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
Protein Snake coagglutinin beta chain [88867] (10 species) heterodimeric coagulation factors IX/X-binding protein (IX/X-BP) |
Species Sharp-nosed viper (Deinagkistrodon acutus) [TaxId:36307] [88871] (3 PDB entries) |
Domain d1iodb_: 1iod B: [62623] Other proteins in same PDB: d1ioda_, d1iodg_ complexed with ca |
PDB Entry: 1iod (more details), 2.3 Å
SCOPe Domain Sequences for d1iodb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iodb_ d.169.1.1 (B:) Snake coagglutinin beta chain {Sharp-nosed viper (Deinagkistrodon acutus) [TaxId: 36307]} dcpsdwssyeghcykpfnepknwadaenfctqqhtgshlvsfqsteeadfvvklafqtfd ygifwmglskiwnqcnwqwsnaamlkytdwaeesycvyfkstnnkwrsitcrmianfvce fqa
Timeline for d1iodb_: