SCOP 1.57: Domain d1iodb_: 1iod B:

Lineage for d1iodb_ (1iod B:)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)

4. Superfamily d.169.1: C-type lectin-like [56436] (5 families)

5. Family d.169.1.1: C-type lectin domain [56437] (15 proteins)

6. Protein Snake coagglutinin [56446] (4 species)

7. Species Sharp-nosed viper (Deinagkistrodon acutus) [TaxId:36307] [64456] (1 PDB entry)

8. Domain d1iodb_: 1iod B: [62623]
   Other proteins in same PDB: d1iodg_

Details for d1iodb_

PDB Entry: 1iod, 2.3 Å

PDB Description: crystal structure of the complex between the coagulation factor x binding protein from snake venom and the gla domain of factor x

SCOP Domain Sequences for d1iodb_:

Sequence; same for both SEQRES and ATOM records:

>d1iodb_ d.169.1.1 (B:) Snake coagglutinin {Sharp-nosed viper (Deinagkistrodon acutus)}
dcpsdwssyeghcykpfnepknwadaenfctqqhtgshlvsfqsteeadfvvklafqtfd
ygifwmglskiwnqcnwqwsnaamlkytdwaeesycvyfkstnnkwrsitcrmianfvce
fqa

Timeline for d1iodb_:

• d1iodb_ is new in SCOP 1.57
  
• d1iodb_ appears in SCOP 1.59
  
• d1iodb_ appears in the current release, SCOPe 2.08