Lineage for d1in6a2 (1in6 A:17-254)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870969Family c.37.1.20: Extended AAA-ATPase domain [81269] (43 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 2871097Protein Holliday junction helicase RuvB [52713] (2 species)
    contains "winged helix" DNA-binding domain after the family specific domains
  7. 2871098Species Thermotoga maritima [TaxId:2336] [64037] (6 PDB entries)
  8. 2871101Domain d1in6a2: 1in6 A:17-254 [62602]
    Other proteins in same PDB: d1in6a1
    complexed with act, adp, co; mutant

Details for d1in6a2

PDB Entry: 1in6 (more details), 1.8 Å

PDB Description: thermotoga maritima ruvb k64r mutant
PDB Compounds: (A:) holliday junction DNA helicase ruvb

SCOPe Domain Sequences for d1in6a2:

Sequence, based on SEQRES records: (download)

>d1in6a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]}
qflrpksldefigqenvkkklslaleaakmrgevldhvllagppglgrttlahiiaselq
tnihvtsgpvlvkqgdmaailtslergdvlfideihrlnkaveellysaiedfqidimig
kgpsaksiridiqpftlvgattrsgllssplrsrfgiileldfytvkelkeiikraaslm
dveiedaaaemiakrsrgtpriairltkrvrdmltvvkadrintdivlktmevlnidd

Sequence, based on observed residues (ATOM records): (download)

>d1in6a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]}
qflrpksldefigqenvkkklslaleaakmrgevldhvllagppglgrttlahiiaselq
tnihvtsgpvlvkqgdmaailtslergdvlfideihrlnkaveellysaiedfqididiq
pftlvgattrsgllssplrsrfgiileldfytvkelkeiikraaslmdveiedaaaemia
krsrgtpriairltkrvrdmltvvkadrintdivlktmevlnidd

SCOPe Domain Coordinates for d1in6a2:

Click to download the PDB-style file with coordinates for d1in6a2.
(The format of our PDB-style files is described here.)

Timeline for d1in6a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1in6a1