SCOPe 2.07: Domain d1ijaa_: 1ija A:

Lineage for d1ijaa_ (1ija A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.100: Sortase [63816] (1 superfamily)
   barrel, closed; n=8, S=10; mixed sheet; two overside connections

4. Superfamily b.100.1: Sortase [63817] (2 families)

5. Family b.100.1.1: Sortase [63818] (3 proteins)

6. Protein Sortase A [63819] (2 species)

7. Species Staphylococcus aureus [TaxId:1280] [63820] (5 PDB entries)
   Uniprot Q9S446 61-206

8. Domain d1ijaa_: 1ija A: [62484]

Details for d1ijaa_

PDB Entry: 1ija

PDB Description: structure of sortase

PDB Compounds: (A:) Sortase

SCOPe Domain Sequences for d1ijaa_:

Sequence; same for both SEQRES and ATOM records:

>d1ijaa_ b.100.1.1 (A:) Sortase A {Staphylococcus aureus [TaxId: 1280]}
mqakpqipkdkskvagyieipdadikepvypgpatpeqlnrgvsfaeeneslddqnisia
ghtfidrpnyqftnlkaakkgsmvyfkvgnetrkykmtsirdvkptdvgvldeqkgkdkq
ltlitcddynektgvwekrkifvatevk

Timeline for d1ijaa_:

• d1ijaa_ first appeared in SCOP 1.57
  
• d1ijaa_ appears in SCOPe 2.06
  
• d1ijaa_ appears in the current release, SCOPe 2.08