Lineage for d1ijaa_ (1ija A:)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.100: Sortase [63816] (1 superfamily) Superfamily b.100.1: Sortase [63817] (1 family) 
Family b.100.1.1: Sortase [63818] (1 protein) Protein Sortase [63819] (1 species) Species Staphylococcus aureus [TaxId:1280] [63820] (1 PDB entry) 
Domain d1ijaa_: 1ija A: [62484]
Details for d1ijaa_
PDB Entry: 1ija (more details)
PDB Description: structure of sortase
SCOP Domain Sequences for d1ijaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ijaa_ b.100.1.1 (A:) Sortase {Staphylococcus aureus}
mqakpqipkdkskvagyieipdadikepvypgpatpeqlnrgvsfaeeneslddqnisia
ghtfidrpnyqftnlkaakkgsmvyfkvgnetrkykmtsirdvkptdvgvldeqkgkdkq
ltlitcddynektgvwekrkifvatevk
SCOP Domain Coordinates for d1ijaa_:
Click to download the PDB-style file with coordinates for d1ijaa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ijaa_:
- d1ijaa_ is new in SCOP 1.57
- d1ijaa_ appears in SCOP 1.59
- d1ijaa_ appears in the current release, SCOPe 2.08
View in 3D