Lineage for d1ijaa_ (1ija A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2409175Fold b.100: Sortase [63816] (1 superfamily)
    barrel, closed; n=8, S=10; mixed sheet; two overside connections
  4. 2409176Superfamily b.100.1: Sortase [63817] (2 families) (S)
  5. 2409177Family b.100.1.1: Sortase [63818] (3 protein domains)
  6. 2409183Protein Sortase A [63819] (1 species)
  7. 2409184Species Staphylococcus aureus [TaxId:1280] [63820] (5 PDB entries)
    Uniprot Q9S446 61-206
  8. 2409195Domain d1ijaa_: 1ija A: [62484]

Details for d1ijaa_

PDB Entry: 1ija (more details)

PDB Description: Structure of Sortase
PDB Compounds: (A:) Sortase

SCOPe Domain Sequences for d1ijaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ijaa_ b.100.1.1 (A:) Sortase A {Staphylococcus aureus [TaxId: 1280]}
mqakpqipkdkskvagyieipdadikepvypgpatpeqlnrgvsfaeeneslddqnisia
ghtfidrpnyqftnlkaakkgsmvyfkvgnetrkykmtsirdvkptdvgvldeqkgkdkq
ltlitcddynektgvwekrkifvatevk

SCOPe Domain Coordinates for d1ijaa_:

Click to download the PDB-style file with coordinates for d1ijaa_.
(The format of our PDB-style files is described here.)

Timeline for d1ijaa_: