Lineage for d1ii4c_ (1ii4 C:)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.42: beta-Trefoil [50352] (5 superfamilies) Superfamily b.42.1: Cytokine [50353] (2 families) 
Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (5 proteins) Protein Basic FGF (FGF2) [50355] (1 species) Species Human (Homo sapiens) [TaxId:9606] [50356] (16 PDB entries) 
Domain d1ii4c_: 1ii4 C: [62402]
Other proteins in same PDB: d1ii4e1, d1ii4e2, d1ii4f1, d1ii4f2, d1ii4g1, d1ii4g2, d1ii4h1, d1ii4h2
Details for d1ii4c_
PDB Entry: 1ii4 (more details), 2.7 Å
PDB Description: crystal structure of ser252trp apert mutant fgf receptor 2 (fgfr2) in complex with fgf2
SCOP Domain Sequences for d1ii4c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ii4c_ b.42.1.1 (C:) Basic FGF (FGF2) {Human (Homo sapiens)}
fppghfkdpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvsan
rylamkedgrllasksvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktg
pgqkailflpmsak
SCOP Domain Coordinates for d1ii4c_:
Click to download the PDB-style file with coordinates for d1ii4c_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ii4c_:
- d1ii4c_ is new in SCOP 1.57
- d1ii4c_ appears in SCOP 1.59
- d1ii4c_ appears in the current release, SCOPe 2.08
View in 3D
