Lineage for d1ii4h2 (1ii4 H:251-361)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 54281Family b.1.1.4: I set domains [49159] (22 proteins)
  6. 54308Protein Fibroblast growth factor receptor, FGFR [49179] (2 species)
  7. 54322Species Human (Homo sapiens), FGFR2 [TaxId:9606] [49181] (5 PDB entries)
  8. 54348Domain d1ii4h2: 1ii4 H:251-361 [62411]
    Other proteins in same PDB: d1ii4a_, d1ii4b_, d1ii4c_, d1ii4d_

Details for d1ii4h2

PDB Entry: 1ii4 (more details), 2.7 Å

PDB Description: crystal structure of ser252trp apert mutant fgf receptor 2 (fgfr2) in complex with fgf2

SCOP Domain Sequences for d1ii4h2:

Sequence, based on SEQRES records: (download)

>d1ii4h2 b.1.1.4 (H:251-361) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2}
rwphrpilqaglpanastvvggdvefvckvysdaqphiqwikhvekngskygpdglpylk
vlkaagvnttdkeievlyirnvtfedageytclagnsigisfhsawltvlp

Sequence, based on observed residues (ATOM records): (download)

>d1ii4h2 b.1.1.4 (H:251-361) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2}
rwphrpilqaglpanastvvggdvefvckvysdaqphiqwikhvpylkvlkaagvnttdk
eievlyirnvtfedageytclagnsigisfhsawltvlp

SCOP Domain Coordinates for d1ii4h2:

Click to download the PDB-style file with coordinates for d1ii4h2.
(The format of our PDB-style files is described here.)

Timeline for d1ii4h2: