PDB entry 1ii4

View 1ii4 on RCSB PDB site
Description: crystal structure of ser252trp apert mutant fgf receptor 2 (fgfr2) in complex with fgf2
Deposited on 2001-04-20, released 2001-05-09
The last revision prior to the SCOP 1.57 freeze date was dated 2001-06-20, with a file datestamp of 2001-06-20.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.238
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ii4A (A:)
    fppghfkdpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvsan
    rylamkedgrllasksvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktg
    pgqkailflpmsak
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ii4B (B:)
    fppghfkdpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvsan
    rylamkedgrllasksvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktg
    pgqkailflpmsak
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ii4C (C:)
    fppghfkdpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvsan
    rylamkedgrllasksvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktg
    pgqkailflpmsak
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ii4D (D:)
    fppghfkdpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvsan
    rylamkedgrllasksvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktg
    pgqkailflpmsak
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1ii4E (E:)
    nkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykv
    rnqhwslimesvvpsdkgnytcvveneygsinhtyhldvverwphrpilqaglpanastv
    vggdvefvckvysdaqphiqwikhvekngskygpdglpylkvlkaagvnttdkeievlyi
    rnvtfedageytclagnsigisfhsawltvlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ii4E (E:)
    nkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykv
    rnqhwslimesvvpsdkgnytcvveneygsinhtyhldvverwphrpilqaglpanastv
    vggdvefvckvysdaqphiqwikhvpylkvlkaagvnttdkeievlyirnvtfedageyt
    clagnsigisfhsawltvlp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1ii4F (F:)
    nkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykv
    rnqhwslimesvvpsdkgnytcvveneygsinhtyhldvverwphrpilqaglpanastv
    vggdvefvckvysdaqphiqwikhvekngskygpdglpylkvlkaagvnttdkeievlyi
    rnvtfedageytclagnsigisfhsawltvlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ii4F (F:)
    nkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykv
    rnqhwslimesvvpsdkgnytcvveneygsinhtyhldvverwphrpilqaglpanastv
    vggdvefvckvysdaqphiqwikhvpylkvlkaagvnttdkeievlyirnvtfedageyt
    clagnsigisfhsawltvlp
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1ii4G (G:)
    nkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykv
    rnqhwslimesvvpsdkgnytcvveneygsinhtyhldvverwphrpilqaglpanastv
    vggdvefvckvysdaqphiqwikhvekngskygpdglpylkvlkaagvnttdkeievlyi
    rnvtfedageytclagnsigisfhsawltvlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ii4G (G:)
    nkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykv
    rnqhwslimesvvpsdkgnytcvveneygsinhtyhldvverwphrpilqaglpanastv
    vggdvefvckvysdaqphiqwikhvpylkvlkaagvnttdkeievlyirnvtfedageyt
    clagnsigisfhsawltvlp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1ii4H (H:)
    nkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykv
    rnqhwslimesvvpsdkgnytcvveneygsinhtyhldvverwphrpilqaglpanastv
    vggdvefvckvysdaqphiqwikhvekngskygpdglpylkvlkaagvnttdkeievlyi
    rnvtfedageytclagnsigisfhsawltvlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ii4H (H:)
    nkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykv
    rnqhwslimesvvpsdkgnytcvveneygsinhtyhldvverwphrpilqaglpanastv
    vggdvefvckvysdaqphiqwikhvpylkvlkaagvnttdkeievlyirnvtfedageyt
    clagnsigisfhsawltvlp