SCOP 1.57: Domain d1ii4f1: 1ii4 F:150-250

Lineage for d1ii4f1 (1ii4 F:150-250)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (22 proteins)

6. Protein Fibroblast growth factor receptor, FGFR [49179] (2 species)

7. Species Human (Homo sapiens), FGFR2 [TaxId:9606] [49181] (5 PDB entries)

8. Domain d1ii4f1: 1ii4 F:150-250 [62406]
   Other proteins in same PDB: d1ii4a_, d1ii4b_, d1ii4c_, d1ii4d_

Details for d1ii4f1

PDB Entry: 1ii4, 2.7 Å

PDB Description: crystal structure of ser252trp apert mutant fgf receptor 2 (fgfr2) in complex with fgf2

SCOP Domain Sequences for d1ii4f1:

Sequence; same for both SEQRES and ATOM records:

>d1ii4f1 b.1.1.4 (F:150-250) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2}
nkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykv
rnqhwslimesvvpsdkgnytcvveneygsinhtyhldvve

Timeline for d1ii4f1:

• d1ii4f1 is new in SCOP 1.57
  
• d1ii4f1 appears in SCOP 1.59
  
• d1ii4f1 appears in the current release, SCOPe 2.08