Class a: All alpha proteins [46456] (290 folds) |
Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily) multihelical; consists of two all-alpha subdomains contains a 4-helical bundle with left-handed twist and up-and-down topology |
Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) |
Family a.91.1.1: Regulator of G-protein signaling, RGS [48098] (10 proteins) |
Protein p115RhoGEF [63584] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [63585] (1 PDB entry) |
Domain d1iapa_: 1iap A: [62119] N-terminal RGS domain |
PDB Entry: 1iap (more details), 1.9 Å
SCOPe Domain Sequences for d1iapa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iapa_ a.91.1.1 (A:) p115RhoGEF {Human (Homo sapiens) [TaxId: 9606]} sqfqsleqvkrrpahlmallqhvalqfepgpllcclhadmlgslgpkeakkafldfyhsf lektavlrvpvppnvafeldrtradlisedvqrrfvqevvqsqqvavgrqledfrskrlm gmtpweqelaqleawvgrdrasyearerhvaerllmhleemqhtistdeeksaavvnaig lymrhlgvrt
Timeline for d1iapa_: